This is a working overview of Neurotrophic signalling, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2025-09-01. Anything still debated is marked as such rather than presented as settled.
Identity and purity are confirmed with reversed-phase high-performance liquid chromatography, typically monitored at 214 nanometres where the peptide bond absorbs. Mass spectrometry, either electrospray or MALDI-TOF, verifies molecular mass against the theoretical value and detects truncation or adduct formation. Amino acid analysis and peptide mapping provide additional confirmation when required. The most frequently reported impurities are deletion sequences from incomplete coupling, methionine sulfoxide from oxidation, and dimeric species formed through non-covalent aggregation. Impurity profiles depend strongly on the synthesis and purification route chosen by the producer.
Published research has focused mainly on neurological and cognitive endpoints in animal models, with proposed mechanisms involving brain-derived neurotrophic factor and related signalling pathways. A substantial share of the human data originates from a limited number of research groups, and independent replication in other countries remains sparse. Regulatory status reflects that distribution: the peptide is registered as a medicine in Russia and appears in some neighbouring markets, while elsewhere it is handled as a research chemical without approved therapeutic labelling. Questions about dose-response relationships, long-term effects, and comparability across studies are still open.
Lyophilised powder is normally kept at -20 °C in a desiccated container, with some suppliers recommending -80 °C for long-term archival storage. Repeated freeze-thaw cycles are the most common cause of avoidable loss, so aliquoting before freezing reduces variability between working sessions. Dissolved peptide is far less stable than the dry solid and is usually prepared fresh or held briefly at 4 °C. Aqueous solutions support both hydrolysis of the backbone and oxidation of the N-terminal methionine, and these two routes dominate degradation under ordinary laboratory conditions.
The compound is registered in Russia as a pharmaceutical product, most commonly formulated as a nasal solution, and has been used in that setting since the 1990s. Outside that jurisdiction it is generally handled as a research chemical rather than an approved medicine. Regulatory status therefore differs sharply between countries, and material sold internationally may not correspond to the Russian pharmaceutical formulation. Documentation with commercial samples is typically limited to a certificate of analysis covering purity and identity, not clinical status or local legal classification.
Semax is a synthetic heptapeptide with the sequence Met-Glu-His-Phe-Pro-Gly-Pro. It corresponds to the ACTH(4-7) fragment extended at the C-terminus by a Pro-Gly-Pro tripeptide, an addition intended to slow enzymatic breakdown. The molecular formula is C37H51N9O10S and the molecular mass is approximately 814 daltons. In the literature it is often described as an ACTH(4-10) analog, although that label reflects a naming convention as much as a precise structural relationship. The compound was developed in Russia and remains most closely associated with that research tradition.
Laboratory descriptions of the material are consistent across suppliers. It appears as a white to off-white lyophilized powder that dissolves readily in water and in polar organic solvents such as dimethyl sulfoxide. Aqueous solutions are clear and colorless at low concentrations. Because the peptide contains methionine, oxidation at the sulfur atom is a recognized degradation pathway, and handling notes usually call for protected, desiccated storage. Reported purity for research-grade lots is generally above 95 percent as measured by reversed-phase high-performance liquid chromatography.
| Property | Value | Notes |
|---|---|---|
| Purity assay | RP-HPLC, UV 214 nm | Typical research grade 95 percent or higher |
| Mass confirmation | ESI-MS or MALDI-TOF | Compared with theoretical value |
| Main degradation route | Methionine oxidation | Sulfoxide formation in solution |
| Powder storage | -20 °C, desiccated | Amber vial, minimal headspace |
| Working solution | Sterile water or saline | Prepare fresh; avoid repeated thawing |
Identity and purity are established with standard peptide methods. Reversed-phase HPLC with ultraviolet detection near 214 nm resolves the parent peak from deletion and truncation byproducts, and reports typically quote a main-peak percentage. Mass spectrometry by electrospray or MALDI-TOF confirms the expected molecular mass, while amino acid analysis or peptide mapping can verify composition when the sequence itself is in question. A certificate of analysis that pairs a chromatogram with a mass spectrum is more informative than a purity figure alone. Counter-ion content and residual solvents are separate specifications and are frequently omitted.
Semax is normally supplied as a lyophilized powder, and that form is the most stable. Suppliers commonly recommend storage at -20 °C in a desiccated container protected from light, with short-term handling at room temperature limited to weighing and transfer. Powder that has absorbed moisture degrades faster, so vials should be warmed to ambient temperature before opening to prevent condensation on the contents. Hygroscopic behavior is typical of short hydrophilic peptides, and humidity control matters more than temperature alone for long-term retention.
Scientific literature on semax is unevenly distributed. A substantial share of published work originates from a small number of laboratories in Russia, while independent replication elsewhere is limited. Human data consist mostly of small trials with short follow-up, and several reported outcomes rely on subjective rating scales. Questions about how much intact peptide reaches the central nervous system after nasal administration, and how long it persists there, are still unresolved. The compound is best described as an active research subject rather than a settled pharmacological agent.
Semax is a synthetic heptapeptide with the sequence Met-Glu-His-Phe-Pro-Gly-Pro. It was derived from the ACTH(4-10) fragment, a short segment of adrenocorticotropic hormone that lacks the hormonal activity associated with the full-length peptide. Researchers at the Institute of Molecular Genetics in Moscow developed the compound during the 1980s. It has been registered as a pharmaceutical product in Russia and several neighbouring countries, where it is supplied as a nasal solution, and it is also sold internationally as a research chemical.
The proposed mechanism centres on neurotrophic signalling rather than direct receptor activation. Semax is reported to increase expression of brain-derived neurotrophic factor and nerve growth factor in several brain regions, and to shift the balance between excitatory and inhibitory neurotransmitter systems. Interaction with melanocortin receptors has been suggested because of the parent ACTH fragment. Many of these findings come from rodent studies, and the extent to which they translate to human physiology remains an open question.
Published studies are dominated by animal models of stroke, ischemia, and cognitive impairment, with a smaller number of human trials conducted in Russia. Many of the human reports are small, single-center, and published in Russian-language journals, which limits independent scrutiny. Outcome measures vary between studies and often rely on clinician-rated scales rather than objective biomarkers. Systematic reviews have noted the methodological weaknesses and called for larger, preregistered trials before firm conclusions can be drawn.
Claims about enhanced focus, memory, or mood in healthy people rest mostly on anecdotal reports and community discussion rather than on controlled data. It remains unclear whether any cognitive benefit observed in patients recovering from brain injury would extend to uninjured users. Dose-response relationships, long-term safety, and interactions with other drugs are not well characterized in the peer-reviewed literature. Questions about optimal route of administration and treatment duration likewise remain open.
Semax binds to melanocortin receptors and is thought to influence neuronal survival and plasticity rather than to act through the adrenal axis. Laboratory work has shown increased expression of brain-derived neurotrophic factor and nerve growth factor in treated tissue. Changes in c-Fos, a marker of neuronal activation, have also been reported. Because the peptide is rapidly degraded by peptidases, its effects are generally attributed to downstream signaling cascades rather than to sustained receptor occupancy.
=== Table of standard amino acid alpha-helical propensities === Estimated differences in free energy change, Δ(ΔG), estimated in kcal/mol per residue in an α-helical configuration, relative to alanine arbitrarily set as zero. Higher numbers (more positive free energy changes) are less favoured. Significant deviations from these average numbers are possible, depending on the identities of the neighbouring residues.
Ronald Charles Dean (August 15, 1938 – October 5, 2025) was an American film and television actor. He appeared in films including Risky Business, The Breakfast Club, Cocktail, The Babe, The Fugitive, Rudy, The Client, and The Dark Knight. He is known for having often played detectives and other law-enforcement characters, most notably as Det. Marion Zeke Crumb in the fantasy comedy-drama television series Early Edition.
Bobby's Vegas Gamble – Covers the opening of Mesa Grill Las Vegas. Restaurant Revamp – Flay tries to help a family restaurant. Chefography: Bobby Flay – Biography of Flay's life and career. Tasting Ireland – Flay takes a food tour of Ireland, his ancestral homeland. Food Network Awards – The Food Network recognizes people and places that have impacted the food world. All-Star Grill Fest: South Beach – Flay joins Paula Deen, Giada De Laurentiis, Alton Brown, and Tyler Florence for a barbecue. In October 2021, Variety reported that Flay would leave Food Network after a 27-year run, after he and the network failed to reach an agreement on a new contract. People reported that Flay had sought $100 million as part of the proposal. In November 2021, it was reported that Flay had signed a new three-year deal with Food Network.
Automated insulin delivery systems are automated (or semi-automated) systems designed to assist people with insulin-requiring diabetes, by automatically adjusting insulin delivery in response to blood glucose levels. Currently available systems (as of October 2020) can only deliver (and regulate delivery of) a single hormone—insulin. Other systems currently in development aim to improve on current systems by adding one or more additional hormones that can be delivered as needed, providing something closer to the endocrine functionality of the pancreas. The endocrine functionality of the pancreas is provided by islet cells which produce the hormones insulin and glucagon. Artificial pancreatic technology mimics the secretion of these hormones into the bloodstream in response to the body's changing blood glucose levels. Maintaining balanced blood sugar levels is crucial to the function of the brain, liver, and kidneys. Therefore, for people with diabetes, it is necessary that the levels be kept balanced when the body cannot produce insulin itself. Automated insulin delivery (AID) systems are often referred to using the term artificial pancreas, but the term has no precise, universally accepted definition. For uses other than automated insulin delivery, see Artificial pancreas (disambiguation).
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
Sources: en.wikipedia.org
In January 2026, the American Civil Liberties Union, Center for Constitutional Rights, and Jonathan Hafetz filed a federal lawsuit against the United States government on behalf of the families of two people from Las Cuevas, Trinidad and Tobago who were killed in a strike on 14 October 2025. The lawsuit alleged that the strikes were "premeditated and intentional killings" that "lack any plausible legal justification" and were "simply murder, ordered at the highest levels of government and obeyed by military officers in the chain of command."
This bonding mode is observed in the commonly available metal carbonyls: Co2(CO)8, Fe2(CO)9, Fe3(CO)12, and Co4(CO)12. In certain higher nuclearity clusters, CO bridges between three or even four metals. These ligands are denoted μ3-CO and μ4-CO. Less common are bonding modes in which both C and O bond to the metal, such as μ3η2.
== Side effects == The effects of local skin reactions with clascoterone were similar to placebo in two large phase III randomized controlled trials. Suppression of the hypothalamic–pituitary–adrenal axis (HPA axis) may occur during clascoterone therapy in some individuals due to its cortexolone metabolite. HPA axis suppression as measured by the cosyntropin stimulation test was observed to occur in 3 of 42 (7%) of adolescents and adults using clascoterone for acne. HPA axis function returned to normal within 4 weeks following discontinuation of clascoterone. Hyperkalemia (elevated potassium levels) occurred in 5% of clascoterone-treated individuals and 4% of placebo-treated individuals.
16 April – A review suggests that global prevalence of long COVID conditions after infection could be as high as 43%, with the most common symptoms being fatigue and memory problems. 19 April – NASA publishes its Planetary Science Decadal Survey for 2023-2032. The future mission recommendations include a Uranus orbiter (the first visit to the planet since 1986) and the Enceladus Orbilander (landing in the early 2050s). 20 April Micronovae, a previously unknown class of thermonuclear explosions on the surface of white dwarfs, are described for the first time. A study shows that common single-use plastic products – such as paper coffee cups that are lined with a thin plastic film inside – release trillions of microplastics-nanoparticles per liter into water during normal use. 21 April – Researchers discover that humans are interrupting a 66-million-years-old feature of ecosystems, the relationship between diet and body mass, by driving the largest vertebrate animals towards extinction, which they suggest could have unpredictable consequences. 22 April The Large Hadron Collider recommences full operations, three years after being shut down for upgrades. Scientists suggest in a study that space governance of satellites/space debris should regulate the current free externalization of true costs and risks, with orbital space around the Earth being an "additional ecosystem" which should be subject to regulations as e.g. oceans on Earth.
Thorburn Brailsford Robertson (4 March 1884 – 18 January 1930), generally known as Brailsford Robertson, was an Australian academic, physiologist, biochemist, gerontologist, and animal nutritionist. Driven by his view, "Do the best you can with what you have where you are", he was "widely regarded as having possessed a rare capacity both as a teacher and researcher". Robertson's assignment of the rights to his tethelin patent (BR.18, BR.19) to the University of California (UC.6) in September 1917 is universally treated as a landmark precedent event in the subsequent development of what is now known as university technology transfer. His initial research interests were in the physical and biochemical processes underlying nervous activity, cognition, human growth, and senescence. Following the Canadian discovery of insulin, he became deeply involved in both researching the insulin treatment of diabetes mellitus and the Australian production of insulin, which he undertook (in mid-1922) with the direct permission (and precise details of its production) of the Head of the Physiology Department of the University of Toronto, John Macleod, Robertson's former assistant at Toronto, centred on the campus of the University of Adelaide: not only refining and purifying its extraction from bovine pancreases, but also significantly reducing its cost per dose, prior to its full-scale commercial production being transferred to the Commonwealth Serum Laboratories on 1 May 1924.
Sources: en.wikipedia.org
Reversed-phase HPLC gives the main purity figure, most often with UV detection near 214 nanometres. Mass spectrometry then confirms the molecular mass. Together the two methods distinguish a correct sequence from a closely related impurity.
The main chemical risks are methionine oxidation and backbone hydrolysis in solution. Moisture and repeated temperature cycling accelerate both processes. Dry powder held cold and desiccated is considerably more stable than any reconstituted preparation.
It holds a medicine registration in Russia, where it has been used clinically for decades. In most other countries it is treated as a research chemical. That split explains the uneven distribution of clinical literature.
It is registered as a pharmaceutical product in Russia, where it is typically supplied as a nasal solution. In most other countries it is not an approved drug and is traded as a research chemical instead. Approval status depends entirely on the jurisdiction involved.