If you have been reading about Melanocortin receptor and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2025-09-06. Numbers and descriptions here follow the published literature rather than marketing material.
Semax binds to melanocortin receptors and is thought to influence neuronal survival and plasticity rather than to act through the adrenal axis. Laboratory work has shown increased expression of brain-derived neurotrophic factor and nerve growth factor in treated tissue. Changes in c-Fos, a marker of neuronal activation, have also been reported. Because the peptide is rapidly degraded by peptidases, its effects are generally attributed to downstream signaling cascades rather than to sustained receptor occupancy.
Published studies are dominated by animal models of stroke, ischemia, and cognitive impairment, with a smaller number of human trials conducted in Russia. Many of the human reports are small, single-center, and published in Russian-language journals, which limits independent scrutiny. Outcome measures vary between studies and often rely on clinician-rated scales rather than objective biomarkers. Systematic reviews have noted the methodological weaknesses and called for larger, preregistered trials before firm conclusions can be drawn.
Laboratory descriptions of the material are consistent across suppliers. It appears as a white to off-white lyophilized powder that dissolves readily in water and in polar organic solvents such as dimethyl sulfoxide. Aqueous solutions are clear and colorless at low concentrations. Because the peptide contains methionine, oxidation at the sulfur atom is a recognized degradation pathway, and handling notes usually call for protected, desiccated storage. Reported purity for research-grade lots is generally above 95 percent as measured by reversed-phase high-performance liquid chromatography.
The compound is registered in Russia as a pharmaceutical product, most commonly formulated as a nasal solution, and has been used in that setting since the 1990s. Outside that jurisdiction it is generally handled as a research chemical rather than an approved medicine. Regulatory status therefore differs sharply between countries, and material sold internationally may not correspond to the Russian pharmaceutical formulation. Documentation with commercial samples is typically limited to a certificate of analysis covering purity and identity, not clinical status or local legal classification.
| Property | Value | Notes |
|---|---|---|
| Appearance | White lyophilized powder | Typical for synthetic peptides |
| Solubility | Freely soluble in water | Also soluble in saline |
| Storage temperature | -20 C or below | Protect from repeated freeze-thaw |
| Analytical method | Reverse-phase HPLC | Confirms purity and identity |
| Common synonym | ACTH(4-10) analog | Reflects structural origin |
Common degradation pathways include oxidation of the methionine side chain, hydrolysis of the peptide backbone, and aggregation under unfavourable pH or concentration. Stability studies typically monitor the main peak by chromatography and report total related substances as a percentage. Because no official monograph exists, acceptance criteria vary between laboratories, and reported purity values are not directly comparable across suppliers. Analysts therefore document the method, column, and detection wavelength alongside each result, and open questions remain about how much biological activity the oxidised forms retain.
Solid semax is typically supplied as a lyophilised powder that is hygroscopic and sensitive to moisture, light, and repeated temperature cycling. Long-term storage of the dry peptide is generally recommended at approximately -20 degrees Celsius, while shorter working periods may use refrigeration at 2 to 8 degrees Celsius. Vials should remain tightly closed and desiccated when brought to room temperature, because condensation can damage the material before it is weighed. Dividing a batch into aliquots is preferable to thawing one container repeatedly.
Dissolution is normally performed in water, phosphate-buffered saline, or normal saline, since the peptide is freely soluble in aqueous media and is rarely handled with strong organic solvents. Solution pH should be kept near neutral, because extreme acidity or alkalinity accelerates backbone hydrolysis and encourages oxidation of the methionine side chain. Once dissolved, the material is less stable than the dry powder and is commonly divided into single-use portions and frozen. Buffers containing primary amines, such as Tris, are often avoided because of possible side reactions.
Development of the compound took place in the Soviet Union during the 1980s, largely through peptide research groups affiliated with the Shemyakin-Ovchinnikov Institute and Moscow State University. Investigators screened fragments of adrenocorticotropic hormone for activity on the central nervous system while attempting to separate cognitive effects from hormonal ones. The shortened sequence was selected because it retained behavioral activity in animal models without stimulating corticosteroid release. Early publications described the molecule as an ACTH(4-10) analog.
Published research on this peptide originates mainly from Russian laboratories, and the wider international literature is comparatively thin. Studies have used rodent models of stroke, hypoxia, and memory tasks, with a smaller number of human trials reported. Reported outcomes include changes in attention and memory measures, along with effects on neurotrophic factor expression in some experiments. Small sample sizes, inconsistent dosing protocols, and limited independent replication are widely noted limitations, so the strength of the clinical evidence remains an open question.
Semax is a synthetic heptapeptide whose sequence is Met-Glu-His-Phe-Pro-Gly-Pro. The first four residues correspond to the ACTH(4-10) fragment, while the terminal Pro-Gly-Pro extension was added to improve metabolic stability. Its molecular formula is C37H51N9O10S and its monoisotopic mass is approximately 813.9 Da. The compound is classified as a peptide research chemical and as a registered pharmaceutical product in Russia, but it does not hold marketing approval in the European Union or the United States. Naming conventions vary across supplier catalogs.
March 12, 2010: Canada 21,000 jobs were created in Canada as of February 2010. However, employers are still not hiring people in most places including Stelco and other jobs that are in rural areas like Norfolk County, Ontario.
Puffballs are a type of fungus featuring a ball-shaped fruiting body that, when mature, bursts on contact or impact, releasing a cloud of dust-like spores into the surrounding area. Puffballs belong to the division Basidiomycota and encompass several genera, including Calvatia, Calbovista and Lycoperdon. The puffballs were previously treated as a taxonomic group called the Gasteromycetes or Gasteromycetidae, but they are now known to be a polyphyletic assemblage. The distinguishing feature of all puffballs is that they do not have an open cap with spore-bearing gills. Instead, spores are produced internally, in a spheroidal fruit body called a gasterothecium (gasteroid 'stomach-like' basidiocarp). As the spores mature, they form a mass called a gleba in the centre of the fruitbody that is often of a distinctive color and texture. The basidiocarp remains closed until after the spores have been released from the basidia. Eventually, it develops an aperture, or dries, becomes brittle, and splits, and the spores escape. The spores of puffballs are statismospores rather than ballistospores, meaning they are not forcibly extruded from the basidium. Puffballs and similar forms are thought to have evolved convergently (that is, in numerous independent events) from Hymenomycetes by gasteromycetation, through secotioid stages. Thus, 'Gasteromycetes' and 'Gasteromycetidae' are now considered to be descriptive, morphological terms (more properly gasteroid or gasteromycetes, to avoid taxonomic implications) but not valid cladistic terms.
=== Modern era === Since the 2000s, tamago kake gohan has seen a resurgence in popularity, marked by the development of specialized condiments, dedicated restaurants, regional promotion efforts, and export.
===== Interferon production ===== Because of powerful interferon stimulating properties, before recombinant interferon alpha became available for medical use, SeV was selected, among other viruses, for the industrial large-scale IFN production. A procedure involving inactivated SeV treatment of human peripheral blood leukocytes from donors' blood was used for this production. Below is a table that listed known PRRs and interferon regulatory factors that are getting activated upon SeV infection.
Sources: en.wikipedia.org
Saccharomyces cerevisiae alcohol dehydrogenase 4 (gene ADH4) Zymomonas mobilis alcohol dehydrogenase 2 (gene adhB) Escherichia coli propanediol oxidoreductase EC 1.1.1.77 (gene fucO), an enzyme involved in the metabolism of fucose and which also seems to contain ferrous ion(s). Clostridium acetobutylicum NADPH- and NADH-dependent butanol dehydrogenases EC 1.1.1.- (genes adh1, bdhA and bdhB), enzymes that have activity using butanol and ethanol as substrates. E. coli adhE, an iron-dependent enzyme that harbours three different activities: alcohol dehydrogenase, acetaldehyde dehydrogenase (acetylating) EC 1.2.1.10 and pyruvate-formate-lyase deactivase. Bacterial glycerol dehydrogenase EC 1.1.1.6 (gene gldA or dhaD). Clostridium kluyveri NAD-dependent 4-hydroxybutyrate dehydrogenase (4hbd) EC 1.1.1.61 Citrobacter freundii and Klebsiella pneumoniae 1,3-propanediol dehydrogenase EC 1.1.1.202 (gene dhaT) Bacillus methanolicus NAD-dependent methanol dehydrogenase EC 1.1.1.244 E. coli and Salmonella typhimurium ethanolamine utilization protein eutG. E. coli hypothetical protein yiaY.
=== Surface plasmon resonance === The SBP-Tag has been used to reversibly immobilize recombinant proteins onto streptavidin-functionalized surfaces thereby permitting interaction assessment such as by surface plasmon resonance (SPR) techniques with re-use of the functionalized surface. SPR has also been used to compare the SBP-Tag with other streptavidin-binding peptides such as Strep-tag.
MD-derived structure predictions can be tested through community-wide experiments in Critical Assessment of Protein Structure Prediction (CASP), although the method has historically had limited success in this area. Michael Levitt, who shared the Nobel Prize partly for the application of MD to proteins, wrote in 1999 that CASP participants usually did not use the method due to "... a central embarrassment of molecular mechanics, namely that energy minimization or molecular dynamics generally leads to a model that is less like the experimental structure". Improvements in computational resources permitting more and longer MD trajectories, combined with modern improvements in the quality of force field parameters, have yielded some improvements in both structure prediction and homology model refinement, without reaching the point of practical utility in these areas; many identify force field parameters as a key area for further development. MD simulation has been reported for pharmacophore development and drug design. For example, Pinto et al. implemented MD simulations of Bcl-xL complexes to calculate average positions of critical amino acids involved in ligand binding. Carlson et al. implemented molecular dynamics simulations to identify compounds that complement a receptor while causing minimal disruption to the conformation and flexibility of the active site. Snapshots of the protein at constant time intervals during the simulation were overlaid to identify conserved binding regions (conserved in at least three out of eleven frames) for pharmacophore development.
Sources: en.wikipedia.org
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
Steven Wilson, the leader of Porcupine Tree, was responsible for remixing King Crimson's back catalogue in surround sound and said that the process had an enormous influence on his solo albums, and his band was influenced by King Crimson. In November 2012 the Flaming Lips in collaboration with Stardeath and White Dwarfs released a track-by-track reinterpretation of In the Court of the Crimson King entitled Playing Hide and Seek with the Ghosts of Dawn. Colin Newman, of Wire, said he saw King Crimson perform many times, and that they influenced him deeply. The seminal hardcore punk group Black Flag acknowledge Wetton-era King Crimson as an influence on their experimental period in the mid-1980s. Melvin Gibbs said that the Rollins Band was influenced most by King Crimson, using similar chords. Bad Religion cites the lyrics of "21st Century Schizoid Man" on their single "21st Century (Digital Boy)" and the name of their record label, Epitaph (founded by their guitarist Brett Gurewitz), comes from the song of the same name on Crimson's debut album. Living Colour guitarist Vernon Reid considered Robert Fripp as one of his guitar influences. King Crimson have frequently been cited as pioneers of progressive metal and as an influence on bands of this genre, including Dream Theater, Opeth, Mastodon, Between the Buried and Me, Leprous, Haken, the Ocean, Caligula's Horse, Last Chance to Reason, and Indukti. Members of metal bands Testament, Mudvayne, Voivod, Enslaved, Yob, Pyrrhon, and Pallbearer have cited King Crimson as an influence.
Villa Erica (Heather Villa): suggesting a Romano-British origin Bellerīca: a medieval Latin word meaning 'dyehouse or tanhouse' Billers: a traditional name for watercress, for which Bilbrook in Somerset and Staffordshire are named. Watercress was farmed in Billericay springs during the 20th century. Although the precise etymology of the name is not known, England has places similarly named:
Thionyl chloride is an inorganic compound with the chemical formula SOCl2. It is a moderately volatile, colourless liquid with an unpleasant acrid odour. Thionyl chloride is primarily used as a chlorinating reagent, with approximately 45,000 tonnes (50,000 short tons) per year being produced during the early 1990s, but is occasionally also used as a solvent. It is toxic, reacts with water, and is also listed under the Chemical Weapons Convention as it may be used for the production of chemical weapons. Thionyl chloride is sometimes confused with sulfuryl chloride, SO2Cl2, but the properties of these compounds differ significantly. Sulfuryl chloride is a source of chlorine whereas thionyl chloride is a source of chloride ions.
Sources: en.wikipedia.org
It is associated with the melanocortin receptor family, particularly subtypes found in the central nervous system. This interaction is separate from the adrenal pathway activated by full-length ACTH.
Peptidases degrade the compound within minutes in circulation. This short half-life is one reason nasal delivery is used, placing the substance close to the olfactory and trigeminal pathways.
No large multicenter trials have been published in English-language journals. The existing human evidence consists mainly of smaller studies conducted in Russia, which limits generalization.
It is registered as a pharmaceutical product in Russia, where it is typically supplied as a nasal solution. In most other countries it is not an approved drug and is traded as a research chemical instead. Approval status depends entirely on the jurisdiction involved.